PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00314.1_g00012.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NAC
Protein Properties Length: 275aa    MW: 31527.5 Da    PI: 8.8175
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00314.1_g00012.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM164.83e-51181431128
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkat 86 
                              lppGf+FhP+d+elv++yL k+++++  +   v+ evd++k+ePwd+p++++ + +ewyf+s++d+kyatg+r+nrat+sgyWkat
  Rsa1.0_00314.1_g00012.1  18 LPPGFKFHPRDDELVCDYLMKRTARSLYQP-VVLIEVDLNKCEPWDIPQTARVGCREWYFYSQKDRKYATGQRTNRATASGYWKAT 102
                              79********************99988776.6899*************98888999****************************** PP

                      NAM  87 gkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                              gkd+++++ +g+lvg++ktLvfykgrapkg ktdWvmhe+rl
  Rsa1.0_00314.1_g00012.1 103 GKDRAIHR-NGSLVGMRKTLVFYKGRAPKGCKTDWVMHEFRL 143
                              *******9.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.57E-5810168IPR003441NAC domain
PROSITE profilePS5100554.83118167IPR003441NAC domain
PfamPF023652.2E-2519143IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 275 aa     Download sequence    Send to blast
MEVKEENKGS ISMVEANLPP GFKFHPRDDE LVCDYLMKRT ARSLYQPVVL IEVDLNKCEP  60
WDIPQTARVG CREWYFYSQK DRKYATGQRT NRATASGYWK ATGKDRAIHR NGSLVGMRKT  120
LVFYKGRAPK GCKTDWVMHE FRLHGTFLHH APNPLKEEWV LCRVFHKNNN EVNRDNNMRS  180
CSNQNASALM DSYINFDHHI NQQVPCFSNL NQTNQSGFDT KNPNPLSKPS SDQMVLRVLL  240
SQLTKSGKES QSYGEGSAES QLTDTGIPSL DAWNY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-521416911170Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013691173.10.0PREDICTED: NAC domain-containing protein 21/22-like
SwissprotQ84TE61e-122NAC22_ARATH; NAC domain-containing protein 21/22
TrEMBLA0A078CZK80.0A0A078CZK8_BRANA; BnaA03g32550D protein
STRINGBra001480.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM36192859
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G12977.11e-161NAC family protein